cis-2-Hydroxy 4-methoxycinnamic acid 2-glucoside
CAS No. 150892-86-7
cis-2-Hydroxy 4-methoxycinnamic acid 2-glucoside ( )
Catalog No. M32591 CAS No. 150892-86-7
The herbs of Acanthopanax gracilistylus.
Purity : >98% (HPLC)
Size | Price / USD | Stock | Quantity |
50MG | Get Quote | In Stock |
|
100MG | Get Quote | In Stock |
|
Biological Information
-
Product Namecis-2-Hydroxy 4-methoxycinnamic acid 2-glucoside
-
NoteResearch use only, not for human use.
-
Brief DescriptionThe herbs of Acanthopanax gracilistylus.
-
DescriptionThe herbs of Acanthopanax gracilistylus.
-
Synonyms
-
PathwayOthers
-
TargetOther Targets
-
Recptor——
-
Research Area——
-
Indication——
Chemical Information
-
CAS Number150892-86-7
-
Formula Weight356.3
-
Molecular FormulaC16H20O9
-
Purity>98% (HPLC)
-
SolubilityDMSO, Pyridine, Methanol, Ethanol, etc.
-
SMILES——
-
Chemical Name
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
-
Phenyl-ac-Gly-OH
Phenylacetylglycine is an acyl glycine. Acyl glycines are normally minor metabolites of fatty acids. The presence of phenylacetylglycine in urine has been confirmed for dogs rats and mice. However the presence of this compound in human urine is controversial. GC-MS studies have not found this compound while NMR studies claimed to have identified it.
-
Exendin-4 peptide de...
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
-
N-Isopropylnoratropi...
N-Isopropylnoratropine is a noratropine derivative and an intermediate in the production of ipratropium, an atropine-like bronchodilator drug via an anticholinergic pathway.