Home - Products - Others - Other Targets - cis-2-Hydroxy 4-methoxycinnamic acid 2-glucoside

cis-2-Hydroxy 4-methoxycinnamic acid 2-glucoside

CAS No. 150892-86-7

cis-2-Hydroxy 4-methoxycinnamic acid 2-glucoside ( )

Catalog No. M32591 CAS No. 150892-86-7

The herbs of Acanthopanax gracilistylus.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
50MG Get Quote In Stock
100MG Get Quote In Stock

Biological Information

  • Product Name
    cis-2-Hydroxy 4-methoxycinnamic acid 2-glucoside
  • Note
    Research use only, not for human use.
  • Brief Description
    The herbs of Acanthopanax gracilistylus.
  • Description
    The herbs of Acanthopanax gracilistylus.
  • Synonyms
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    150892-86-7
  • Formula Weight
    356.3
  • Molecular Formula
    C16H20O9
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO, Pyridine, Methanol, Ethanol, etc.
  • SMILES
    ——
  • Chemical Name

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Phenyl-ac-Gly-OH

    Phenylacetylglycine is an acyl glycine. Acyl glycines are normally minor metabolites of fatty acids. The presence of phenylacetylglycine in urine has been confirmed for dogs rats and mice. However the presence of this compound in human urine is controversial. GC-MS studies have not found this compound while NMR studies claimed to have identified it.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • N-Isopropylnoratropi...

    N-Isopropylnoratropine is a noratropine derivative and an intermediate in the production of ipratropium, an atropine-like bronchodilator drug via an anticholinergic pathway.